|
Compound class:
Endogenous peptide in human, mouse or rat
Comment: This is the endogenous ligand of the thrombopoietin receptor. It promotes proliferation of megakaryocytic cells, which leads to increased platelet production. Human TPO is not used therapeutically as it is associated with a risk of immunogenicity and the development of neutralizing anti-TPO antibodies [1-2]. As a result of this outcome small molecule TPO receptor agonists have been developed to mimic the platelet-promoting action of native TPO.
Species: Human
View more information in the IUPHAR Pharmacology Education Project: thrombopoietin |
Peptide Sequence  |
|
|
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQ LGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTA VPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLF PGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNT SYTHSQNLSQEG |
|
| Post-translational Modification | |
| O-linked glycosylation of predicted N-linked glycosylation of asparagine residues at positions 319 and 327; disulphide bond formation between cysteine residues at positions 7 and 151, and 29 and 85 | |
