GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

thrombopoietin   Click here for help

GtoPdb Ligand ID: 5063

Comment: This is the endogenous ligand of the thrombopoietin receptor. It promotes proliferation of megakaryocytic cells, which leads to increased platelet production. Human TPO is not used therapeutically as it is associated with a risk of immunogenicity and the development of neutralizing anti-TPO antibodies [1-2]. As a result of this outcome small molecule TPO receptor agonists have been developed to mimic the platelet-promoting action of native TPO.
Species: Human
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: thrombopoietin

Peptide Sequence Click here for help
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQ
LGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTA
VPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLF
PGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNT
SYTHSQNLSQEG
Post-translational Modification
O-linked glycosylation of predicted N-linked glycosylation of asparagine residues at positions 319 and 327; disulphide bond formation between cysteine residues at positions 7 and 151, and 29 and 85