VEGFB

Ligand id: 5086

Name: VEGFB

Species: Human

Peptide Sequence
PVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQI
LMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAPS
TTSALTPGPAAAAADAAASSVAKGGA
Selected 3D Structures
PDB Id: 2c7w
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Homodimer formed by interchain disulphide bonds between cysteine residues at positions 51 and 60; further disulphide bonds formed between cysteine residues at positions 26 and 68, 57 and 102, and 61 and 103.