Peptide Sequence

FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEI SVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR

Post-translational Modification

Homodimer formed by interchain disulphide bonds between cysteine residues at positions 48 and 57; further disulphide bonds formed between cysteine residues at positions 23 and 65, 54 and 101, and 58 and 103. N-linked glycosylation of asparagine residues at positions 67 and 97; predicted N-linked glycosylation of asparagine at 199