GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

VEGFD   Click here for help

GtoPdb Ligand ID: 5088

Synonyms: c-fos induced growth factor | FIGF
Species: Human
Peptide Sequence Click here for help
FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEI
SVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR
Post-translational Modification
Homodimer formed by interchain disulphide bonds between cysteine residues at positions 48 and 57; further disulphide bonds formed between cysteine residues at positions 23 and 65, 54 and 101, and 58 and 103. N-linked glycosylation of asparagine residues at positions 67 and 97; predicted N-linked glycosylation of asparagine at 199