GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

Rac3   Click here for help

GtoPdb Ligand ID: 5252

Synonyms: p21-Rac3 | ras-related C3 botulinum toxin substrate 3
Species: Human
Peptide Sequence Click here for help
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLI
CFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSAL
TQRGLKTVFDEAIRAVLCPPPVKKPGKKC
Post-translational Modification
Threonine residue at position 167 is phosphothreonine; C-terminal cysteine residue is predicted to undergo lipidation to become S-geranylgeranyl cysteine