GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

TIMP1   Click here for help

GtoPdb Ligand ID: 5309

Synonyms: fibroblast collagenase inhibitor | metalloproteinase inhibitor 1
Species: Human
Peptide Sequence Click here for help
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRS
EEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQ
SRHLACLPREPGLCTWQSLRSQIA
Post-translational Modification
N-linked glycosylation of asparagine residues at positions 30 and 78; disulphide bond formation between cysteine residues at positions 1 and 70, 3 and 99, 13 and 124, 127 and 174, 132 and 137 and 145 and 166.