GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

TIMP2   Click here for help

GtoPdb Ligand ID: 5310

Synonyms: CSC-21K | TIMP-2
Species: Human
Peptide Sequence Click here for help
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGG
KKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGH
QAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 1 and 72, 3 and 101, 13 and 126, 128 and 175, 133 and 138 and 146 and 167