GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

PDGFD   Click here for help

GtoPdb Ligand ID: 5323

Synonyms: Iris-expressed growth factor (IEGF) | PDGF-D
Comment: The peptide sequence provided here is the predicted receptor-binding form, taken from its UniProt entry. The active form of this protein is a disulphide-linked homodimer.
Species: Human
Peptide Sequence Click here for help
SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHE
VLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR