CTR-stimulating peptide

Ligand id: 5369

Name: CTR-stimulating peptide

Species: Pig

Peptide Sequence
SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG
Ser-Cys-Asn-Thr-Ala-Thr-Cys-Met-Thr-His-Arg-Leu-Val-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Ser-Met-Val-Arg-Ser-Asn-Leu-Leu-Pro-Thr-Lys-Met-Gly-Phe-Lys-Val-Phe-Gly
Post-translational Modification
C-terminal glycine residue undergoes amidation;; disulphide bond formation between cysteine residues at positions 2 and 7