FSH α subunit-deglycosylated form

Ligand id: 5536

Name: FSH α subunit-deglycosylated form

Is a component of
Peptide Sequence
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKQVTSESTCCVAKSYNRVTVMGGFKVEQHT
ACHCSTCYYHKS
Chemical Modification
Asparagine residues at positions 52 and 78 of the natural sequence which undergo glycosylation in the formation of active FSH are replaced by glutamine residues