Peptide Sequence

TLQKKIEEIAAKYKHSVVKKCCYDGAAVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISFKRS

Thr-Leu-Gln-Lys-Lys-Ile-Glu-Glu-Ile-Ala-Ala-Lys-Tyr-Lys-His-Ser-Val-Val-Lys-Lys-Cys-Cys-Tyr-Asp-Gly-Ala-Ala-Val-Asn-Asn-Asp-Glu-Thr-Cys-Glu-Gln-Arg-Ala-Ala-Arg-Ile-Ser-Leu-Gly-Pro-Arg-Cys-Ile-Lys-Ala-Phe-Thr-Glu-Cys-Cys-Val-Val-Ala-Ser-Gln-Leu-Arg-Ala-Asn-Ile-Ser-Phe-Lys-Arg-Ser

Chemical Modification

The natural sequence of C5a is C-terminally truncated (residues 71-74 are removed). Cysteine residue at position 27 of the natural sequence of C5a is replaced with alanine, histidine residue at position 67 is replaced with phenylalanine, aspartic acid residue at position 69 is replaced with arginine and methionine residue at position 70 is replaced with serine.