A8Δ71-73   Click here for help

GtoPdb Ligand ID: 5780

Compound class: Peptide
Comment: Synthetic analogue of a mutated form of C5a [1]. It is a dual C5a1/C5a2 antagonist.
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
TLQKKIEEIAAKYKHSVVKKCCYDGAAVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISFKRS
Thr-Leu-Gln-Lys-Lys-Ile-Glu-Glu-Ile-Ala-Ala-Lys-Tyr-Lys-His-Ser-Val-Val-Lys-Lys-Cys-Cys-Tyr-Asp-Gly-Ala-Ala-Val-Asn-Asn-Asp-Glu-Thr-Cys-Glu-Gln-Arg-Ala-Ala-Arg-Ile-Ser-Leu-Gly-Pro-Arg-Cys-Ile-Lys-Ala-Phe-Thr-Glu-Cys-Cys-Val-Val-Ala-Ser-Gln-Leu-Arg-Ala-Asn-Ile-Ser-Phe-Lys-Arg-Ser
Chemical Modification
The natural sequence of C5a is C-terminally truncated (residues 71-74 are removed). Cysteine residue at position 27 of the natural sequence of C5a is replaced with alanine, histidine residue at position 67 is replaced with phenylalanine, aspartic acid residue at position 69 is replaced with arginine and methionine residue at position 70 is replaced with serine.