GALP(1-32) (human)   

GtoPdb Ligand ID: 6121

Peptide Sequence
APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQD
Ala-Pro-Ala-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Leu-Pro-Gln-Met-Gly-Asp-Gln-Asp