GALP(3-32) (human)

Ligand id: 6122

Name: GALP(3-32) (human)

Structure and Physico-chemical Properties

2D Structure
Peptide Sequence
AHRGRGGWTLNSAGYLLGPVLHLPQMGDQD
Ala-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Leu-Pro-Gln-Met-Gly-Asp-Gln-Asp
Download 2D Structure
Canonical SMILES Download
Isomeric SMILES Download
InChI standard identifier Download
InChI standard key Download

Molecular structure representations generated using Open Babel