GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

palifermin   Click here for help

GtoPdb Ligand ID: 6954

Synonyms: Kepivance® | keratinocyte growth factor
Approved drug
palifermin is an approved drug (FDA (2004), EMA (2005))
Compound class: Peptide
Comment: Palfermin is a modified truncated form of human keratinocyte growth factor produced by recombinant DNA technology.
Peptide Sequence Click here for help
MSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKEC
NEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Chemical Modification
This peptide is fibroblast growth factor 7 (amino acids 23-163) with a methionine substitution at Met23