GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

BP-CCL3   Click here for help

GtoPdb Ligand ID: 752

Synonyms: BP-LD78α | BP-MIP-1α | photoactivatable macrophage inflammatory protein-1α
Compound class: Peptide
Comment: Photoaffinity analogue of human CCL3
Click here for help
Peptide Sequence Click here for help
SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
p-benzoylphenylthiocarbamyl-Ser-Leu-Ala-Ala-Asp-Thr-Pro-Thr-Ala-Cys-Cys-Phe-Ser-Tyr-Thr-Ser-Arg-Gln-Ile-Pro-Gln-Asn-Phe-Ile-Ala-Asp-Tyr-Phe-Glu-Thr-Ser-Ser-Gln-Cys-Ser-Lys-Pro-Gly-Val-Ile-Phe-Leu-Thr-Lys-Arg-Ser-Arg-Gln-Val-Cys-Ala-Asp-Pro-Ser-Glu-Glu-Trp-Val-Gln-Lys-Tyr-Val-Ser-Asp-Leu-Glu-Leu-Ser-Ala
Chemical Modification
N-terminal serine bonded to p-benzoylphenylthiocarbamyl group