GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CCL14   Click here for help

GtoPdb Ligand ID: 753

Synonyms: CCL14a | CKβ1 | haemofiltrate CC chemokine 1 (HCC-1) | HCC-1(1-74)
Immunopharmacology Ligand
Comment: The ligand is cleaved from the precursor C-C motif chemokine 14 (represents residues 20-93)
Species: Human
Click here for help
Peptide Sequence Click here for help
TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Thr-Lys-Thr-Glu-Ser-Ser-Ser-Arg-Gly-Pro-Tyr-His-Pro-Ser-Glu-Cys-Cys-Phe-Thr-Tyr-Thr-Thr-Tyr-Lys-Ile-Pro-Arg-Gln-Arg-Ile-Met-Asp-Tyr-Tyr-Glu-Thr-Asn-Ser-Gln-Cys-Ser-Lys-Pro-Gly-Ile-Val-Phe-Ile-Thr-Lys-Arg-Gly-His-Ser-Val-Cys-Thr-Asn-Pro-Ser-Asp-Lys-Trp-Val-Gln-Asp-Tyr-Ile-Lys-Asp-Met-Lys-Glu-Asn
Selected 3D Structures
PDB Id: 2Q8T
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Glycosylated CCL14 is one of the predominant forms. N-terminally truncated forms are also identified [3]. For further information see UniProt