GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

huwentoxin IV   Click here for help

GtoPdb Ligand ID: 7570

Synonyms: huwentoxin-4 | HwTx-IV
Compound class: Peptide
Comment: Toxin from Haplopelma schmidti (Chinese bird spider).
Click here for help
Peptide Sequence Click here for help
ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI
Glu-Cys-Leu-Glu-Ile-Phe-Lys-Ala-Cys-Asn-Pro-Ser-Asn-Asp-Gln-Cys-Cys-Lys-Ser-Ser-Lys-Leu-Val-Cys-Ser-Arg-Lys-Thr-Arg-Trp-Cys-Lys-Tyr-Gln-Ile
Post-translational Modification
C terminal residue is isoleucine amide. Disulphide bond formation between cysteine residues at positions 2 and 17, 9 and 24, and 16 and 31.