insulin glargine   Click here for help

GtoPdb Ligand ID: 7572

Synonyms: HOE-901 | HOE901 | Lantus®
Approved drug
insulin glargine is an approved drug (FDA and EMA (2000))
Comment: Insulin glargine is a recombinant, modified analogue of human insulin. A fixed-ratio formulation containing insulin glargine and lixisenatide is being assessed in clinical trials for the treatment of type 2 diabetes. Click here to view a list of such trials registered with ClinicalTrials.gov.

Biosimilar drugs: Insulin glargine biosimilar SB9 is in development by Samsung Bioepis
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: glargine

Peptide Sequence Click here for help
No information available.
Chemical Modification
The A chain has peptide sequence GIVEQCCTSICSLYQLENYCG, where the C terminal glycine replaces the natural asparagine. The B chain has the sequence FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR which has two additional C-terminal arginine residues compared to endogenous insulin. Disulphide bond formation is equivalent to that observed in the endogenous active hormone dimer.