apelin receptor early endogenous ligand

Ligand id: 7931

Name: apelin receptor early endogenous ligand

Species: Mouse

Peptide Sequence
KPVNFPRRRKLYRHNCFRRRCIPLHSRVPFP
Lys-Pro-Val-Asn-Phe-Pro-Arg-Arg-Arg-Lys-Leu-Tyr-Arg-His-Asn-Cys-Phe-Arg-Arg-Arg-Cys-Ile-Pro-Leu-His-Ser-Arg-Val-Pro-Phe-Pro
Post-translational Modification
31 amino acid peptide cleaved from the 54 amino acid precursor (UniProt ID P0DMC4).