GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: Ende
Compound class:
Endogenous peptide in human, mouse or rat
Comment: This is the mouse homologue of human apelin receptor early endogenous ligand.
Species: Mouse
|
Peptide Sequence ![]() |
|
KPVNFPRRRKLYRHNCFRRRCIPLHSRVPFP | |
Lys-Pro-Val-Asn-Phe-Pro-Arg-Arg-Arg-Lys-Leu-Tyr-Arg-His-Asn-Cys-Phe-Arg-Arg-Arg-Cys-Ile-Pro-Leu-His-Ser-Arg-Val-Pro-Phe-Pro |
Post-translational Modification | |
31 amino acid peptide cleaved from the 54 amino acid precursor (UniProt ID P0DMC4). |