GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CCL22   Click here for help

GtoPdb Ligand ID: 798

Synonyms: dc/β-ck | macrophage-derived chemokine | STCP1
Immunopharmacology Ligand
Comment: CCL22 is a CC family chemokine. It is one of the endogenous agonists for the chemokine receptor CCR4.
Species: Human
Click here for help
Peptide Sequence Click here for help
GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ
Gly-Pro-Tyr-Gly-Ala-Asn-Met-Glu-Asp-Ser-Val-Cys-Cys-Arg-Asp-Tyr-Val-Arg-Tyr-Arg-Leu-Pro-Leu-Arg-Val-Val-Lys-His-Phe-Tyr-Trp-Thr-Ser-Asp-Ser-Cys-Pro-Arg-Pro-Gly-Val-Val-Leu-Leu-Thr-Phe-Arg-Asp-Lys-Glu-Ile-Cys-Ala-Asp-Pro-Arg-Val-Pro-Trp-Val-Lys-Met-Ile-Leu-Asn-Lys-Leu-Ser-Gln
Post-translational Modification
3 N-terminally processed forms are known (MDC(3-69), MDC(5-69), MDC(7-69)) [3].