desulfated gastrin-71

Ligand id: 8410

Name: desulfated gastrin-71

Species: Human

Peptide Sequence
SWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF
Ser-Trp-Lys-Pro-Arg-Ser-Gln-Gln-Pro-Asp-Ala-Pro-Leu-Gly-Thr-Gly-Ala-Asn-Arg-Asp-Leu-Glu-Leu-Pro-Trp-Leu-Glu-Gln-Gln-Gly-Pro-Ala-Ser-His-His-Arg-Arg-Gln-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2