trebananib   Click here for help

GtoPdb Ligand ID: 8414

Synonyms: 2xCon4[C] | AMG-386 | TN8-Con4 [1]
Compound class: Peptide
Comment: Trebananib is an immunoglobulin G1 Fc peptibody [6] (fusion protein). Trebananib is being developed as a potential non-VEGF anti-angiogenesis option for the treatment for recurrent epithelial ovarian cancer [2-3,7].
Peptide Sequence Click here for help
MDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAV
EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGGAQQEECE
WDPWTCEHMGSGSATGGSGSTASSGSGSATHQEECEWDPWTCEHMLE
Chemical Modification
Heterodimer formation linked by inter-chain disulphide bonds between Cys7 on each monomer and Cys10 on each monomer. Intra-chain disulphide bonds are identical on each monomer, forming between Cys42-Cys102, Cys148-Cys206, Cys239-Cys246 and Cys275-Cys282. N-linked glycosylation of Asn78 on each chain. Information from the INN record for trebananib.