GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

vCXCL1   Click here for help

GtoPdb Ligand ID: 8496

Compound class: Peptide
Comment: vCXCL1 is a protein product of the cytomegalovirus UL146 gene. vCXCL1 mimics the host's endogenous chemokine, activating associated chemokine receptors and signalling pathways [1].
Click here for help
Peptide Sequence Click here for help
TELRCCRLHRKWPPNKIILGNYWLHRDPRGPGCDKNEHLLYPDGRKPPGPGVCLSPDHLFSKWLDKHNDNRWYNVNITKS
PGPRRINITLIGVRG