vCXCL1

Ligand id: 8496

Name: vCXCL1

Peptide Sequence
TELRCCRLHRKWPPNKIILGNYWLHRDPRGPGCDKNEHLLYPDGRKPPGPGVCLSPDHLFSKWLDKHNDNRWYNVNITKS
PGPRRINITLIGVRG