GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

[125I]CXCL13 (mouse)   Click here for help

GtoPdb Ligand ID: 8631

 Ligand is labelled  Ligand is radioactive
Compound class: Peptide
Comment: This is a radio-labelled version of mouse CXCL13 that can be used as an experimental probe.
Peptide Sequence Click here for help
ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQA
PVSKRRAA
Ile-Leu-Glu-Ala-His-Tyr-Thr-Asn-Leu-Lys-Cys-Arg-Cys-Ser-Gly-Val-Ile-Ser-Thr-Val-Val-Gly-Leu-Asn-Ile-Ile-Asp-Arg-Ile-Gln-Val-Thr-Pro-Pro-Gly-Asn-Gly-Cys-Pro-Lys-Thr-Glu-Val-Val-Ile-Trp-Thr-Lys-Met-Lys-Lys-Val-Ile-Cys-Val-Asn-Pro-Arg-Ala-Lys-Trp-Leu-Gln-Arg-Leu-Leu-Arg-His-Val-Gln-Ser-Lys-Ser-Leu-Ser-Ser-Thr-Pro-Gln-Ala-Pro-Val-Ser-Lys-Arg-Arg-Ala-Ala
Chemical Modification
Mono-iodinated at the N-terminal amide by the Bolton-Hunter method.