STM 434

Ligand id: 8991

Name: STM 434

Peptide Sequence
SGRGEAETR(W/Y)CIYYNANWELERTNQSGLERCEGEQDKRLHCYASW(A/R)NSSGTIELVKKGCWLDDFNCYDRQEC
VATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTGGGGSVDKTHTCPPCPAPELLGGPSVFLFPPKPKDT
LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA
PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL
TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Chemical Modification
Amino acids 1-116 is the sequence of the variant extracellular domain of the human ActRIIB
Amino acids 117-121 (GGGGS) is the linker
Amino acids 122-349 is the sequence of a partial hinge region and Fc region of human IgG1