GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

adropin   Click here for help

GtoPdb Ligand ID: 9573

Comment: Adropin is a peptide hormone translated form he EHNO gene [2]. Its biological function is poorly understood, but it was originally suggested to be linked to energy homeostasis and lipid metabolism [1-3].
Adropin has been suggested as an endogenous ligand for the orphan GPCR, GPR19 [4-5], although de-orphanisation requires further confirmatory evidence.
The amino acid sequence of this protein in humans, mice and rats is identical.
Species: Human
Click here for help
Peptide Sequence Click here for help
CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
Cys-His-Ser-Arg-Ser-Ala-Asp-Val-Asp-Ser-Leu-Ser-Glu-Ser-Ser-Pro-Asn-Ser-Ser-Pro-Gly-Pro-Cys-Pro-Glu-Lys-Ala-Pro-Pro-Pro-Gln-Lys-Pro-Ser-His-Glu-Gly-Ser-Tyr-Leu-Leu-Gln-Pro
Post-translational Modification
33 amino acid signal peptide (MGAAISQGALIAIVCNGLVGFLLLLLWVILCWA) removed.