GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Synonyms: ZP-1848 | ZP1848
Compound class:
Peptide
Comment: Glepaglutide (ZP1848, Zealand Pharma) is a long-acting human glucagon like peptide-2 (GLP-2) analogue with a C-terminal hexa-lysine addition.
The wild type peptide sequence is HADGSFSDEMNTILDNLAARDFINWLIQTKITD, compared to the glepaglutide sequence which is HGEGTFSSELATILDALAARDFIAWLIATKITDKKKKKK (the hexa-lysine is underlined). GLP-2 receptor agonists have therapeutic potential in clinical indications with compromised absorptive capacity at the intestinal mucosa, such as in short bowel syndrome. GLP-2 analogues have been designed to be less susceptible to enzymatic cleavage and renal clearance and hence have an improved circulating half-life compared to the endogenous peptide. Teduglutide is already approved but has a once-daily injection regimen, so longer-acting analogues are still of development interest. |
|
|||||||||||||||||
| Bioactivity Comments |
| In vitro, glepaglutide is less potent and less selective at the GLP-2 receptor than apraglutide and teduglutide [1]. The elimination half-lives (in a rat PK model) of human glucagon-like peptide 2, teduglutide, glepaglutide, and apraglutide are 6.4, 19, 16, and 159 minutes, respectively. |