From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

muscarinic toxin β   Click here for help

GtoPdb Ligand ID: 13152

Synonyms: Adrenergic toxin rho-elapitoxin-Dp1a | MTβ | rho-EPTX-Dp1a
Compound class: Peptide
Comment: Muscarinic toxin β is a snake venom component produced by the black mamba (Dendroaspis polylepis polylepis). It antagonises human adrenoceptors [1], but despite its name has only weak affinity for mammalian muscarinic receptors.
Click here for help
Peptide Sequence Click here for help
LTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPKIYDITRGCVATCPIPENYDSIHCCKTDKCNE