From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

pancreatic polypeptide   Click here for help

GtoPdb Ligand ID: 1512

Abbreviated name: PP
Species: Human
Click here for help
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: pancreatic polypeptide

Peptide Sequence Click here for help
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY
Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2
Post-translational Modification
The C-terminal tyrosine is amidated.