GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

pancreatic polypeptide   Click here for help

GtoPdb Ligand ID: 1512

Abbreviated name: PP
Species: Human
Click here for help
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: pancreatic polypeptide

Peptide Sequence Click here for help
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY
Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2
Post-translational Modification
The C-terminal tyrosine is amidated.