GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

ω-grammotoxin SIA   Click here for help

GtoPdb Ligand ID: 2539

Synonyms: ω-GrTx SIA | omega-grammotoxin SIA | omega-GsTx SIA | omega-GTX SIA
Compound class: Peptide
Comment: ω-Grammotoxin SIA (GrTx) is a 36 amino acid residue protein toxin from the venom of the spider Grammostola rosea (Chilean rose tarantula) [3].
Click here for help
Peptide Sequence Click here for help
DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV
Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val
Selected 3D Structures
PDB Id: 1KOZ
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
C-terminal valine residue is predicted to be valine-amide; disulphide bond formation between cysteine residues at positions 2 and 16, 9 and 21, and 15 and 30.