GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: cholinergic differentiation factor (CDF) | differentiation-inducing factor (DIF) | human interleukin in DA cells (HILDA)
Compound class:
Endogenous peptide in human, mouse or rat
Comment: LIF is an IL-6 family cytokine.
Species: Human
|
Peptide Sequence ![]() |
|
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKL VELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKK LGCQLLGKYKQIIAVLAQAF |
Selected 3D Structures | ||
|
Post-translational Modification | |
N-linked glycosylation of asparagine residues at positions 9, 34, 63, 73, 96 and 116; disulphide bond formation between cysteine residues at positions 12 and 134, 18 and 131, and 60 and 163 |