GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

LIGHT   Click here for help

GtoPdb Ligand ID: 5070

Synonyms: Herpesvirus entry mediator-ligand | TR2
Immunopharmacology Ligand
Comment: LIGHT is a tumour necrosis factor superfamily protein that regulates T-cell-based inflammatory reactions, especially in mucosal membranes [1-2]. It exists as a membrane-anchored protein and as a soluble form in the serum. LIGHT's biological activity is mediated via binding to TNF superfamily receptors: lymphotoxin β receptor (LTβR; TNFRSF3), herpes virus entry mediator (HVEM; TNFRSF14), and decoy receptor 3 (DcR3; TNFRSF6B).
Species: Human
Peptide Sequence Click here for help
MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSW
EQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLAS
TITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Selected 3D Structures
PDB Id: 3UGN
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
N-linked glycosylation of asparagine residue at position 102; predicted disulphide bond between cysteine resisues at positons 154 and 187