From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

CXCL17   Click here for help

GtoPdb Ligand ID: 6479

Synonyms: C-X-C motif chemokine 17 | dendritic cell and monocyte chemokine-like protein
Immunopharmacology Ligand
Comment: CXCL17 is a CXC family chemokine reported in human and rat, with a mucosal expression pattern.
Species: Human
Peptide Sequence Click here for help
SSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSR
ACQQFLKQCQLRSFALPL
Ser-Ser-Leu-Asn-Pro-Gly-Val-Ala-Arg-Gly-His-Arg-Asp-Arg-Gly-Gln-Ala-Ser-Arg-Arg-Trp-Leu-Gln-Glu-Gly-Gly-Gln-Glu-Cys-Glu-Cys-Lys-Asp-Trp-Phe-Leu-Arg-Ala-Pro-Arg-Arg-Lys-Phe-Met-Thr-Val-Ser-Gly-Leu-Pro-Lys-Lys-Gln-Cys-Pro-Cys-Asp-His-Phe-Lys-Gly-Asn-Val-Lys-Lys-Thr-Arg-His-Gln-Arg-His-His-Arg-Lys-Pro-Asn-Lys-His-Ser-Arg-Ala-Cys-Gln-Gln-Phe-Leu-Lys-Gln-Cys-Gln-Leu-Arg-Ser-Phe-Ala-Leu-Pro-Leu
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 28 and 53, and 30 and 55.