GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

amylin   Click here for help

GtoPdb Ligand ID: 688

Abbreviated name: AMY
Species: Mouse, Rat
Click here for help
Peptide Sequence Click here for help
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
Post-translational Modification
The C-terminal proline is amidated into Pro-NH2 and a disulphide bridge is formed between cysteine residues at positions 2 and 7.