AbGn-168H

Home
Ligands
AbGn-168H

GtoPdb Ligand ID: 10013

Synonyms: AbGn-168 | neihulizumab

Comment: AbGn-168H (neihulizumab) is a first-in-class, humanised anti-P-selectin glycoprotein 1 (PSGL-1) monoclonal antibody that is being developed by AbGenomics [2-3]. AbGn-168H targets the PSGL-1/P-selectin pathway that is involved in leukocyte recruitment to inflammatory sites. It blocks PSGL-1 expressed by activated T cells or NK cells, and inhibits their interaction with P-selectin on endothelial cells of the vasculature. AbGn-168H binds to a different epitope on P-selectin compared to the endogenous ligand PSGL-1 so it is not expected to interfere with the P-selectin-dependent recruitment of leukocytes that is essential for innate immunity. Nor does it alter aggregation of human platelets which express low levels of PSGL-1 [3].
Patent analysis identifies SEQ ID: 25 from AbGenomics' 2009 patent US7604800 [3] as the likely light chain variable region of AbGn-168H (DIQMTQSPSLSASVGDRVTITCRSSQSIVHNDGNTYFEWYQQKPGKAPKLLIYKVSNRFSGVPSRFSGSGSGTHFTLTISSLQPEDFATYYCFQGSYVPLTFGQGTKVEIK) and SEQ ID: 26 that is claimed in the same patent (EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVASISTGGSTYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCARDYDGYFDYWGQGTLVTVSS) is the likely heavy chain. AbGn-168H was humanised from a murine anti-PSGL-1 antibody referred to as 15A7 [3].

References
1. FDA. neihulizumab. Accessed on 02/07/2018. Modified on 02/07/2018. US FDA: Orphan Drug Designations and Approvals, https://www.accessdata.fda.gov/scripts/opdlisting/oopd/detailedIndex.cfm?cfgridkey=622617
2. Lin R-H Wu C-H, Hsu P-L. (2003) Modulators of P-selectin glycoprotein ligand 1. Patent number: US20030049252A1. Assignee: AbGenomics Co. Priority date: 03/08/2001. Publication date: 13/03/2003.
3. Lin R-H, Chang CN, Chen P-J, Huang C-C. (2009) Anti-PSGL-1 antibodies. Patent number: US7604800B2. Assignee: AbGenomics Cooperatief UA. Priority date: 10/05/2004. Publication date: 20/10/2009.

References

1. FDA.
neihulizumab.
Accessed on 02/07/2018. Modified on 02/07/2018. US FDA: Orphan Drug Designations and Approvals, https://www.accessdata.fda.gov/scripts/opdlisting/oopd/detailedIndex.cfm?cfgridkey=622617

2. Lin R-H Wu C-H, Hsu P-L. (2003)
Modulators of P-selectin glycoprotein ligand 1.
Patent number: US20030049252A1. Assignee: AbGenomics Co. Priority date: 03/08/2001. Publication date: 13/03/2003.

3. Lin R-H, Chang CN, Chen P-J, Huang C-C. (2009)
Anti-PSGL-1 antibodies.
Patent number: US7604800B2. Assignee: AbGenomics Cooperatief UA. Priority date: 10/05/2004. Publication date: 20/10/2009.