EK-1-C4   Click here for help

GtoPdb Ligand ID: 11501

Synonyms: EK1C4
Compound class: Peptide or derivative
Comment: This is the lipopeptide version of EK-1 [1]. It has cholesterol fused at the C terminal via a short peptide linker and a flexible polyethylene glycol (PEG) spacer. Like EK-1 it acts as a viral fusion inhibitor that blocks infection by a range of human coronavirus pseudoviruses and live viruses, including SARS-Co-V and SARS-CoV-2. It is significantly more potent than EK-1, and is active in vitro and in vivo.
Peptide Sequence Click here for help
SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG
Ser-Leu-Asp-Gln-Ile-Asn-Val-Thr-Phe-Leu-Asp-Leu-Glu-Tyr-Glu-Met-Lys-Lys-Leu-Glu-Glu-Ala-Ile-Lys-Lys-Leu-Glu-Glu-Ser-Tyr-Ile-Asp-Leu-Lys-Glu-Leu-Gly-Ser-Gly-Ser-Gly
Chemical Modification
C terminal linker GSGSG linking to PEG4-cholesterol