|
Synonyms: RC18 | Tai'ai®
telitacicept is an approved drug (China (2021))
Compound class:
Peptide or derivative
Comment: Telitacicept (RC18) is a recombinant fusion protein that combines the ligand-binding domain of the TACI receptor and the Fc component of human IgG. It was designed to inhibit the signalling of B cell BAFF and APRIL as a mechanism to treat B cell-mediated autoimmune diseases such as systemic lupus erythematosus (SLE), rheumatoid arthritis (RA), multiple sclerosis (MS) and neuromyelitis optica spectrum disorder (NMOSD) [2-5].
|
Peptide Sequence  |
|
|
SRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASI CGQHPKQCAYFCENKLRSPVNLPPELDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK |
|
| Chemical Modification | |
|
Disulfide bridges locations: intra-TACI: 22-35, 38-50, 42-54, 59-74, 77-88, 81-92 intra-IgG1 Fc: 147-207, 253-311 inter-IgG1 Fc: 112-112', 115-115' Glycosylation sites: Asn183, Asn183' |
|
