mamba toxin CM-3   Click here for help

GtoPdb Ligand ID: 13153

Synonyms: Adrenergic toxin rho-elapitoxin-Dp1b | rho-EPTX-Dp1b
Comment: This peptide is a toxin component of black mamba (Dendroaspis polylepis) venom [2]. Its sequence diverges from that of muscarinic toxin β by only two amino acids in its C-terminal. CM-3 has antagonist properties at mammalian adrenoceptors [1].
Click here for help
Peptide Sequence Click here for help
LTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPKIYDITRGCVATCPIPENYDSIHCCKTEKCNN