agouti   

GtoPdb Ligand ID: 1329

Synonyms: ASIP
Species: Mouse
Peptide Sequence
HLALEETLGDDRSLRSNSSMNSLDFSSVSIVALNKKSKKISRKEAEKRKRSSKKKASMKKVARPPPPSPCVATRDSCKPP
APACCDPCASCQCRFFGSACTCRVLNPNC
His-Leu-Ala-Leu-Glu-Glu-Thr-Leu-Gly-Asp-Asp-Arg-Ser-Leu-Arg-Ser-Asn-Ser-Ser-Met-Asn-Ser-Leu-Asp-Phe-Ser-Ser-Val-Ser-Ile-Val-Ala-Leu-Asn-Lys-Lys-Ser-Lys-Lys-Ile-Ser-Arg-Lys-Glu-Ala-Glu-Lys-Arg-Lys-Arg-Ser-Ser-Lys-Lys-Lys-Ala-Ser-Met-Lys-Lys-Val-Ala-Arg-Pro-Pro-Pro-Pro-Ser-Pro-Cys-Val-Ala-Thr-Arg-Asp-Ser-Cys-Lys-Pro-Pro-Ala-Pro-Ala-Cys-Cys-Asp-Pro-Cys-Ala-Ser-Cys-Gln-Cys-Arg-Phe-Phe-Gly-Ser-Ala-Cys-Thr-Cys-Arg-Val-Leu-Asn-Pro-Asn-Cys
Post-translational Modification
Disulfide bonds are formed between cysteine residues 70 and 85, 77 and 91, 84 and 102, 88 and 109, 93 and 100.