[125I]PYY (pig)   

GtoPdb Ligand ID: 1520

Synonyms: [125I]pPYY
   
Peptide Sequence
YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY
Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2