[3H]NPY (human, mouse, rat)

Ligand id: 1521

Name: [3H]NPY (human, mouse, rat)    

Peptide Sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2