prokineticin-2

Ligand id: 1867

Name: prokineticin-2

Species: Human

Peptide Sequence
AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTC
PCLPGLACLRTSFNRFICLAQK
Ala-Val-Ile-Thr-Gly-Ala-Cys-Asp-Lys-Asp-Ser-Gln-Cys-Gly-Gly-Gly-Met-Cys-Cys-Ala-Val-Ser-Ile-Trp-Val-Lys-Ser-Ile-Arg-Ile-Cys-Thr-Pro-Met-Gly-Lys-Leu-Gly-Asp-Ser-Cys-His-Pro-Leu-Thr-Arg-Lys-Asn-Asn-Phe-Gly-Asn-Gly-Arg-Gln-Glu-Arg-Arg-Lys-Arg-Lys-Arg-Ser-Lys-Arg-Lys-Lys-Glu-Val-Pro-Phe-Phe-Gly-Arg-Arg-Met-His-His-Thr-Cys-Pro-Cys-Leu-Pro-Gly-Leu-Ala-Cys-Leu-Arg-Thr-Ser-Phe-Asn-Arg-Phe-Ile-Cys-Leu-Ala-Gln-Lys
Post-translational Modification
There are 5 disulfide bonds formed between cysteine residues at positions 7 and 19, 13 and 31, 18 and 80, 41 and 88, 82 and 98.