cathepsin G   

GtoPdb Ligand ID: 3570

Species: Human

This ligand is also described as a target entry: cathepsin G

Peptide Sequence
IIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQY
NQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYD
PRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL
Ile-Ile-Gly-Gly-Arg-Glu-Ser-Arg-Pro-His-Ser-Arg-Pro-Tyr-Met-Ala-Tyr-Leu-Gln-Ile-Gln-Ser-Pro-Ala-Gly-Gln-Ser-Arg-Cys-Gly-Gly-Phe-Leu-Val-Arg-Glu-Asp-Phe-Val-Leu-Thr-Ala-Ala-His-Cys-Trp-Gly-Ser-Asn-Ile-(GlcNAc)Asn-Val-Thr-Leu-Gly-Ala-His-Asn-Ile-Gln-Arg-Arg-Glu-Asn-Thr-Gln-Gln-His-Ile-Thr-Ala-Arg-Arg-Ala-Ile-Arg-His-Pro-Gln-Tyr-Asn-Gln-Arg-Thr-Ile-Gln-Asn-Asp-Ile-Met-Leu-Leu-Gln-Leu-Ser-Arg-Arg-Val-Arg-Arg-Asn-Arg-Asn-Val-Asn-Pro-Val-Ala-Leu-Pro-Arg-Ala-Gln-Glu-Gly-Leu-Arg-Pro-Gly-Thr-Leu-Cys-Thr-Val-Ala-Gly-Trp-Gly-Arg-Val-Ser-Met-Arg-Arg-Gly-Thr-Asp-Thr-Leu-Arg-Glu-Val-Gln-Leu-Arg-Val-Gln-Arg-Asp-Arg-Gln-Cys-Leu-Arg-Ile-Phe-Gly-Ser-Tyr-Asp-Pro-Arg-Arg-Gln-Ile-Cys-Val-Gly-Asp-Arg-Arg-Glu-Arg-Lys-Ala-Ala-Phe-Lys-Gly-Asp-Ser-Gly-Gly-Pro-Leu-Leu-Cys-Asn-Asn-Val-Ala-His-Gly-Ile-Val-Ser-Tyr-Gly-Lys-Ser-Ser-Gly-Val-Pro-Pro-Glu-Val-Phe-Thr-Arg-Val-Ser-Ser-Phe-Leu-Pro-Trp-Ile-Arg-Thr-Thr-Met-Arg-Ser-Phe-Lys-Leu-Leu-Asp-Gln-Met-Glu-Thr-Pro-Leu
Post-translational Modification
The asparagine residue at position 51 is N-linked glycosylated and there are 3 disulfide bonds formed between the cysteine residues at positions 29 and 45, 122 and 187, and 152 and 166.