beta-defensin 4A   

GtoPdb Ligand ID: 3648

Synonyms: beta-defensin 2 | HBD2 | skin-antimicrobial peptide 1 (SAP1)
Species: Human
Peptide Sequence
GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Gly-Ile-Gly-Asp-Pro-Val-Thr-Cys-Leu-Lys-Ser-Gly-Ala-Ile-Cys-His-Pro-Val-Phe-Cys-Pro-Arg-Arg-Tyr-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Leu-Pro-Gly-Thr-Lys-Cys-Cys-Lys-Lys-Pro
Post-translational Modification
Disulphide bonds between cysteine residues at positions 8 and 37; 15 and 30, and 20 and 38