CCL3   

GtoPdb Ligand ID: 4408

Comment: This is the mouse homolog of human CCL3.
Species: Mouse
Peptide Sequence
APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Ala-Pro-Tyr-Gly-Ala-Asp-Thr-Pro-Thr-Ala-Cys-Cys-Phe-Ser-Tyr-Ser-Arg-Lys-Ile-Pro-Arg-Gln-Phe-Ile-Val-Asp-Tyr-Phe-Glu-Thr-Ser-Ser-Leu-Cys-Ser-Gln-Pro-Gly-Val-Ile-Phe-Leu-Thr-Lys-Arg-Asn-Arg-Gln-Ile-Cys-Ala-Asp-Ser-Lys-Glu-Thr-Trp-Val-Gln-Glu-Tyr-Ile-Thr-Asp-Leu-Glu-Leu-Asn-Ala