CCL19   

GtoPdb Ligand ID: 4417

Comment: This is the mouse homolog of human CCL19.
Species: Mouse
Peptide Sequence
GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRS
PVS
Gly-Ala-Asn-Asp-Ala-Glu-Asp-Cys-Cys-Leu-Ser-Val-Thr-Gln-Arg-Pro-Ile-Pro-Gly-Asn-Ile-Val-Lys-Ala-Phe-Arg-Tyr-Leu-Leu-Asn-Glu-Asp-Gly-Cys-Arg-Val-Pro-Ala-Val-Val-Phe-Thr-Thr-Leu-Arg-Gly-Tyr-Gln-Leu-Cys-Ala-Pro-Pro-Asp-Gln-Pro-Trp-Val-Asp-Arg-Ile-Ile-Arg-Arg-Leu-Lys-Lys-Ser-Ser-Ala-Lys-Asn-Lys-Gly-Asn-Ser-Thr-Arg-Arg-Ser-Pro-Val-Ser