[125I]GDNF (rat)

Ligand id: 4851

Name: [125I]GDNF (rat)    

Peptide Sequence
SPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCEAAETMYD
KILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDSLVYHILRKHSAKRCGCI