Synonyms: Avonex® (recombinant IFN-beta-1a) | fibroblast interferon | interferon beta
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IFN-β is a type I IFN. The peptide sequence of the clinically used recombinant protein IFN-beta-1a is identical to that of the endogenous peptide.
Species: Human
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
Peptide Sequence | |
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL TGYLRN |
Post-translational Modification | |
Phosphorylation of serine residue at position 119; N-linked glycosylation of asparagine residue at position 80; disulphide bond between cysteine residues at positions 31 and 141 |