stem cell factor   Click here for help

GtoPdb Ligand ID: 5055

Abbreviated name: SCF
Synonyms: c-Kit ligand
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: SCF is the endogenous ligand for c-KIT (KIT) receptor tyrosine kinase.
Species: Human
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLV
NIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFML
PPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQE
KEREFQEV
Selected 3D Structures
PDB Id: 1exz
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Partial N linked glycosylation of asparagine residues at positions 65 and 93, N-linked glycosylation of asparagine at position 120; O-linked glycosylation of serine at position 142, and of threonine at positions 143 and 155. Disulphide bond formation between cysteine residues at positions 4 and 89, and 43 and 138. Predicted N-linked glycosylation of asparagine at position 170