GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

stem cell factor   Click here for help

GtoPdb Ligand ID: 5055

Abbreviated name: SCF
Synonyms: c-Kit ligand
Immunopharmacology Ligand
Comment: SCF is the endogenous ligand for c-KIT (KIT) receptor tyrosine kinase.
Species: Human
Click here for help
Peptide Sequence Click here for help
EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLV
NIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFML
PPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQE
KEREFQEV
Selected 3D Structures
PDB Id: 1exz
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Partial N linked glycosylation of asparagine residues at positions 65 and 93, N-linked glycosylation of asparagine at position 120; O-linked glycosylation of serine at position 142, and of threonine at positions 143 and 155. Disulphide bond formation between cysteine residues at positions 4 and 89, and 43 and 138. Predicted N-linked glycosylation of asparagine at position 170