RANK ligand   

GtoPdb Ligand ID: 5066

Synonyms: receptor activator of nuclear factor κB ligand | osteoclast differentiation factor (ODF) | osteoprotegerin ligand | TNFSF11
Comment: RANK ligand (TNFSF11) is a member of the tumor necrosis factor (TNF) cytokine family. It can exist in both membrane-bound and soluble forms. It is a key factor for osteoclast differentiation and activation. Osteoprotegerin acts as a decoy receptor for RANK ligand.
Species: Human
Peptide Sequence
MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQVVCSVALFFYFRAQMDPNRIS
EDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKL
EAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMV
YVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Selected 3D Structures
PDB Id: 1JTZ
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosyaltion of asparagine residues at positions 171 and 198